Recombinant Full Length Human PSG11 Protein

• Cat.No.: PSG11-402HF
• Product Overview: Recombinant full length Human Pregnancy specific beta 1 glycoprotein 11 with N terminal proprietary tag. Predicted MW 50.16 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 219 amino acids
• Description: The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).
• Form: Liquid
• Molecular Mass: 50.160kDa inclusive of tags
• AA Sequence: MHAAEIMGPLSAPPCTEHIKWKGLLLTVETPKPSISSSNL NPREAMETVILTCNPETPDASYLWWMNGQSLPMTHRMQLS ETNRTLFLFGVTKYTAGPYECEIWNSGSASRSDPVTLNLL HGPDLPRIFPSVTSYYSGENLDLSCFADSNPPAQYSWTIN GKFQLSGQKLFIPQITPKHNGLYACSARNSATGEESSTSL TIRVIAPPGLGTFAFNNPT
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: PSG11 pregnancy specific beta-1-glycoprotein 11 [ Homo sapiens ]
• Official Symbol: PSG11
• Synonyms: PSG11; pregnancy specific beta-1-glycoprotein 11; PSG13, PSG14; pregnancy-specific beta-1-glycoprotein 11; MGC22484; pregnancy specific beta 1 glycoprotein 13
• Gene ID: 5680
• mRNA Refseq: NM_001113410
• Protein Refseq: NP_001106881
• MIM: 176401
• UniProt ID: Q9UQ72