Recombinant Full Length Human PRSS8 Protein
Cat.No. : | PRSS8-404HF |
Product Overview : | Recombinant full length Human PRSS8 with N-terminal proprietary tag. Predicted MW 63.47kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 343 amino acids |
Description : | This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine. |
Form : | Liquid |
Molecular Mass : | 63.470kDa inclusive of tags |
AA Sequence : | MAQKGVLGPGQLGAVAILLYLGLLRSGTGAEGAEAPCGVA PQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWV LSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDI IPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANA SFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRET CNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGG PLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASW IQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGL LRPILFLPLGLALGLLSPWLSEH |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PRSS8 protease, serine, 8 [ Homo sapiens ] |
Official Symbol | PRSS8 |
Synonyms | PRSS8; protease, serine, 8; prostasin |
Gene ID | 5652 |
mRNA Refseq | NM_002773 |
Protein Refseq | NP_002764 |
MIM | 600823 |
UniProt ID | Q16651 |
◆ Recombinant Proteins | ||
ABCA9-7645H | Recombinant Human ABCA9 protein, His-tagged | +Inquiry |
CD248A-5733Z | Recombinant Zebrafish CD248A | +Inquiry |
MMP8-446H | Recombinant Human matrix metallopeptidase 8 (neutrophil collagenase), His-tagged | +Inquiry |
GRB10-1970R | Recombinant Rhesus monkey GRB10 Protein, His-tagged | +Inquiry |
RYR2-358H | Recombinant Human RYR2 | +Inquiry |
◆ Native Proteins | ||
Lipoprotein-246 | Native Human Oxidized LDL (Ox-LDL) | +Inquiry |
C-type lectin like protein-040H | Native Hen C-type lectin like protein Protein | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
AMY1B-31376TH | Native Human AMY1B | +Inquiry |
Neuraminidase-006C | Active Native Clostridium perfringens Neuraminidase, Type VI | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPA12B-5359HCL | Recombinant Human HSPA12B 293 Cell Lysate | +Inquiry |
TRIM52-769HCL | Recombinant Human TRIM52 293 Cell Lysate | +Inquiry |
CACNG7-271HCL | Recombinant Human CACNG7 cell lysate | +Inquiry |
EFCAB4A-6708HCL | Recombinant Human EFCAB4A 293 Cell Lysate | +Inquiry |
DPPA4-6825HCL | Recombinant Human DPPA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRSS8 Products
Required fields are marked with *
My Review for All PRSS8 Products
Required fields are marked with *
0
Inquiry Basket