Recombinant Full Length Human Protein Serac1(Serac1) Protein, His-Tagged
Cat.No. : | RFL11502HF |
Product Overview : | Recombinant Full Length Human Protein SERAC1(SERAC1) Protein (Q96JX3) (1-654aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-654) |
Form : | Lyophilized powder |
AA Sequence : | MSLAAYCVICCRRIGTSTSPPKSGTHWRDIRNIIKFTGSLILGGSLFLTYEVLALKKAVT LDTQVVEREKMKSYIYVHTVSLDKGENHGIAWQARKELHKAVRKVLATSAKILRNPFADP FSTVDIEDHECAVWLLLRKSKSDDKTTRLEAVREMSETHHWHDYQYRIIAQACDPKTLIG LARSEESDLRFFLLPPPLPSLKEDSSTEEELRQLLASLPQTELDECIQYFTSLALSESSQ SLAAQKGGLWCFGGNGLPYAESFGEVPSATVEMFCLEAIVKHSEISTHCDKIEANGGLQL LQRLYRLHKDCPKVQRNIMRVIGNMALNEHLHSSIVRSGWVSIMAEAMKSPHIMESSHAA RILANLDRETVQEKYQDGVYVLHPQYRTSQPIKADVLFIHGLMGAAFKTWRQQDSEQAVI EKPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMERKSIAFRSNELLR KLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMSTVINNTRGIIFYSVPHHGSRLA EYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETLPTYIGSMIK LHVVPVESADLGIGDLIPVDVNHLNICKPKKKDAFLYQRTLQFIREALAKDLEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SERAC1 |
Synonyms | SERAC1; Protein SERAC1; Serine active site-containing protein 1 |
UniProt ID | Q96JX3 |
◆ Recombinant Proteins | ||
TNFRSF11B-187H | Recombinant Human TNFRSF11B | +Inquiry |
nirS-907P | Recombinant Pseudomonas perfectomarina nirS protein(127-560aa), His&Myc-tagged | +Inquiry |
DCAF7-3624H | Recombinant Human DCAF7, His-tagged | +Inquiry |
TMEM184B-9335M | Recombinant Mouse TMEM184B Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC39A6-1016H | Active Recombinant Human SLC39A6 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
DES-167C | Native chicken DES | +Inquiry |
Collagen-62B | Native Bovine Collagen Type XI | +Inquiry |
Trypsin-265H | Native Human Trypsin | +Inquiry |
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Pancreas-366R | Rhesus monkey Pancreas Membrane Lysate | +Inquiry |
BAG1-8528HCL | Recombinant Human BAG1 293 Cell Lysate | +Inquiry |
ZNF24-109HCL | Recombinant Human ZNF24 293 Cell Lysate | +Inquiry |
ZG16-171HCL | Recombinant Human ZG16 293 Cell Lysate | +Inquiry |
N4BP2L1-3998HCL | Recombinant Human N4BP2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERAC1 Products
Required fields are marked with *
My Review for All SERAC1 Products
Required fields are marked with *
0
Inquiry Basket