Recombinant Full Length Human Protein Rrnad1(Rrnad1) Protein, His-Tagged
Cat.No. : | RFL4459HF |
Product Overview : | Recombinant Full Length Human Protein RRNAD1(RRNAD1) Protein (Q96FB5) (1-475aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-475) |
Form : | Lyophilized powder |
AA Sequence : | MPGISARGLSHEGRKQLAVNLTRVLALYRSILDAYIIEFFTDNLWDTLPCSWQEALDGLK PPQLATMLLGMPGEGEVVRYRSVWPLTLLALKSTACALAFTRMPGFQTPSEFLENPSQSS RLTAPFRKHVRPKKQHEIRRLGELVKKLSDFTGCTQVVDVGSGQGHLSRFMALGLGLMVK SIEGDQRLVERAQRLDQELLQALEKEEKRNPQVVQTSPRHSPHHVVRWVDPTALCEELLL PLENPCQGRARLLLTGLHACGDLSVALLRHFSCCPEVVALASVGCCYMKLSDPGGYPLSQ WVAGLPGYELPYRLREGACHALEEYAERLQKAGPGLRTHCYRAALETVIRRARPELRRPG VQGIPRVHELKIEEYVQRGLQRVGLDPQLPLNLAALQAHVAQENRVVAFFSLALLLAPLV ETLILLDRLLYLQEQGFHAELLPIFSPELSPRNLVLVATKMPLGQALSVLETEDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RRNAD1 |
Synonyms | METTL25B; C1orf66; RRNAD1; CGI-41; Methyltransferase-like protein 25B; Protein RRNAD1; Ribosomal RNA adenine dimethylase domain-containing protein 1 |
UniProt ID | Q96FB5 |
◆ Recombinant Proteins | ||
HOXB5-1896H | Recombinant Human HOXB5 Protein, His-tagged | +Inquiry |
CSNK2B-1638R | Recombinant Rat CSNK2B Protein | +Inquiry |
TAS2R16-4621R | Recombinant Rhesus monkey TAS2R16 Protein, His-tagged | +Inquiry |
COL27A1-11431H | Recombinant Human COL27A1, GST-tagged | +Inquiry |
GNG7-1907R | Recombinant Rhesus monkey GNG7 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ACE-3047R | Native rabbit ACE | +Inquiry |
THBS1-4946H | Native Human Thrombospondin protein | +Inquiry |
IgG-333T | Native Turkey IgG | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
Collagen Type I & III-06M | Native Mouse Collagen Type I and III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCARA3-2046HCL | Recombinant Human SCARA3 293 Cell Lysate | +Inquiry |
CD5-2572HCL | Recombinant Human CD5 cell lysate | +Inquiry |
NLRP1-3804HCL | Recombinant Human NLRP1 293 Cell Lysate | +Inquiry |
TMEM123-1790HCL | Recombinant Human TMEM123 cell lysate | +Inquiry |
FAM156A-260HCL | Recombinant Human FAM156A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RRNAD1 Products
Required fields are marked with *
My Review for All RRNAD1 Products
Required fields are marked with *
0
Inquiry Basket