Recombinant Full Length Human Protein Rer1(Rer1) Protein, His-Tagged
Cat.No. : | RFL7469HF |
Product Overview : | Recombinant Full Length Human Protein RER1(RER1) Protein (O15258) (1-196aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-196) |
Form : | Lyophilized powder |
AA Sequence : | MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYL LQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFK FWHAATKGILVAMVCTFFDAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHG KRRYRGKEDAGKAFAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RER1 |
Synonyms | RER1; Protein RER1 |
UniProt ID | O15258 |
◆ Recombinant Proteins | ||
ASUN-925H | Recombinant Human ASUN protein, GST-tagged | +Inquiry |
TNFRSF21-3321H | Recombinant Human TNFRSF21, His-tagged | +Inquiry |
NRAS-01H | Active Recombinant Human NRAS Protein, His-tagged | +Inquiry |
CSNK1E-2746H | Recombinant Human CSNK1E protein, His-tagged | +Inquiry |
YOME-3774B | Recombinant Bacillus subtilis YOME protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
IgG-129B | Native Bovine milk Immunoglobulin G | +Inquiry |
Lectin-1797L | Active Native Lotus Tetragonolobus Lectin Protein, Biotinylated | +Inquiry |
REN -16H | Recombinant Human Prorenin, His-tagged | +Inquiry |
Alb-503R | Native Rat Alb Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIF-2970HCL | Recombinant Human PPIF 293 Cell Lysate | +Inquiry |
KCNT1-5014HCL | Recombinant Human KCNT1 293 Cell Lysate | +Inquiry |
TPBG-852HCL | Recombinant Human TPBG 293 Cell Lysate | +Inquiry |
GPM6B-304HCL | Recombinant Human GPM6B lysate | +Inquiry |
BMP1-8436HCL | Recombinant Human BMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RER1 Products
Required fields are marked with *
My Review for All RER1 Products
Required fields are marked with *
0
Inquiry Basket