Recombinant Full Length Human Protein Fam26F(Fam26F) Protein, His-Tagged
Cat.No. : | RFL17487HF |
Product Overview : | Recombinant Full Length Human Protein FAM26F(FAM26F) Protein (Q5R3K3) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MEKFRAVLDLHVKHHSALGYGLVTLLTAGGERIFSAVAFQCPCSAAWNLPYGLVFLLVPA LALFLLGYVLSARTWRLLTGCCSSARASCGSALRGSLVCTQISAAAALAPLTWVAVALLG GAFYECAATGSAAFAQRLCLGRNRSCAAELPLVPCNQAKASDVQDLLKDLKAQSQVLGWI LIAVVIIILLIFTSVTRCLSPVSFLQLKFWKIYLEQEQQILKSKATEHATELAKENIKCF FEGSHPKEYNTPSMKEWQQISSLYTFNPKGQYYSMLHKYVNRKEKTHSIRSTEGDTVIPV LGFVDSSGINSTPEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CALHM6 |
Synonyms | CALHM6; C6orf187; FAM26F; Calcium homeostasis modulator protein 6; Protein FAM26F |
UniProt ID | Q5R3K3 |
◆ Native Proteins | ||
CPA-01B | Native Bovine Pancreas Carboxypeptidase A, Type II-PMSF treated | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
Lectin-1845S | Active Native Soybean Agglutinin Protein, Agarose bound | +Inquiry |
Collagen-57H | Native Human Collagen Type II | +Inquiry |
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADRB2-34HCL | Recombinant Human ADRB2 cell lysate | +Inquiry |
GPC6-5811HCL | Recombinant Human GPC6 293 Cell Lysate | +Inquiry |
THOC6-1092HCL | Recombinant Human THOC6 293 Cell Lysate | +Inquiry |
BOLA1-173HCL | Recombinant Human BOLA1 cell lysate | +Inquiry |
CBS-7809HCL | Recombinant Human CBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALHM6 Products
Required fields are marked with *
My Review for All CALHM6 Products
Required fields are marked with *
0
Inquiry Basket