Recombinant Full Length Human Protein Fam26D(Fam26D) Protein, His-Tagged
Cat.No. : | RFL5846HF |
Product Overview : | Recombinant Full Length Human Protein FAM26D(FAM26D) Protein (Q5JW98) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MCPTLNNIVSSLQRNGIFINSLIAALTIGGQQLFSSSTFSCPCQVGKNFYYGSAFLVIPA LILLVAGFALRSQMWTITGEYCCSCAPPYRRISPLECKLACLRFFSITGRAVIAPLTWLA VTLLTGTYYECAASEFASVDHYPMFDNVSASKREEILAGFPCCRSAPSDVILVRDEIALL HRYQSQMLGWILITLATIAALVSCCVAKCCSPLTSLQHCYWTSHLQNERELFEQAAEQHS RLLMMHRIKKLFGFIPGSEDVKHIRIPSCQDWKDISVPTLLCMGDDLQGHYSFLGNRVDE DNEEDRSRGIELKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CALHM4 |
Synonyms | CALHM4; C6orf78; FAM26D; UNQ6481/PRO21277; Calcium homeostasis modulator protein 4; Protein FAM26D |
UniProt ID | Q5JW98 |
◆ Recombinant Proteins | ||
RPL26-2386H | Recombinant Human RPL26, GST-tagged | +Inquiry |
RFL15514AF | Recombinant Full Length Artibeus Jamaicensis Atp Synthase Protein 8(Mt-Atp8) Protein, His-Tagged | +Inquiry |
TNFSF14-217HAF555 | Recombinant Human TNFSF14 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
MAN2C1-328H | Recombinant Human MAN2C1 Protein, MYC/DDK-tagged | +Inquiry |
SLC22A2-8260M | Recombinant Mouse SLC22A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
Collagen type I-03H | Native Human Collagen type I Protein | +Inquiry |
SERPINC1-8032H | Native Human Plasma AntiThromblin III | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB129-6981HCL | Recombinant Human DEFB129 293 Cell Lysate | +Inquiry |
ATP1B1-919HCL | Recombinant Human ATP1B1 cell lysate | +Inquiry |
Jurkat-010HCL | Human Jurkat Whole Cell Lysate | +Inquiry |
FBXW12-609HCL | Recombinant Human FBXW12 cell lysate | +Inquiry |
ELK1-520HCL | Recombinant Human ELK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CALHM4 Products
Required fields are marked with *
My Review for All CALHM4 Products
Required fields are marked with *
0
Inquiry Basket