Recombinant Full Length Human Protein Fam18B1(Fam18B1) Protein, His-Tagged
Cat.No. : | RFL29810HF |
Product Overview : | Recombinant Full Length Human Protein FAM18B1(FAM18B1) Protein (Q9NYZ1) (1-205aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-205) |
Form : | Lyophilized powder |
AA Sequence : | MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVYLLCGLLSSS FITCMVTIILLLSCDFWAVKNVTGRLMVGLRWWNHIDEDGKSHWVFESRKESSQENKTVS EAESRIFWLGLIACPVLWVIFAFSALFSFRVKWLAVVIMGVVLQGANLYGYIRCKVRSRK HLTSMATSYFGKQFLRQNTGDDQTS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TVP23B |
Synonyms | TVP23B; FAM18B; FAM18B1; CGI-148; NPD008; Golgi apparatus membrane protein TVP23 homolog B |
UniProt ID | Q9NYZ1 |
◆ Native Proteins | ||
CTSG-5327H | Native Human Cathepsin G | +Inquiry |
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
HDL-1539H | Native Human High-density lipoprotein | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
Lectin-1869W | Active Native Wisteria Floribunda Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
ALDH3B2-59HCL | Recombinant Human ALDH3B2 cell lysate | +Inquiry |
COLEC10-001CCL | Recombinant Cynomolgus COLEC10 cell lysate | +Inquiry |
NOV-694HCL | Recombinant Human NOV cell lysate | +Inquiry |
VPS41-386HCL | Recombinant Human VPS41 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TVP23B Products
Required fields are marked with *
My Review for All TVP23B Products
Required fields are marked with *
0
Inquiry Basket