Recombinant Full Length Human Protein Fam156A(Fam156A) Protein, His-Tagged
Cat.No. : | RFL13726HF |
Product Overview : | Recombinant Full Length Human Protein FAM156A(FAM156A) Protein (Q8NDB6) (1-213aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-213) |
Form : | Lyophilized powder |
AA Sequence : | MDPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPGPSQAVPLPE GLLRQRYREEKTLEERRWERLEFLQRKKAFLRHVRRRHRDHMAPYAVGREARISPLGDRS QNRFRCECRYCQSHRPNLSGIPGESNRAPHPSSWETLVQGLSGLTLSLGTNQPGPLPEAA LQPQETEEKRQRERQQESKIMFQRLLKQWLEEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAM156A |
Synonyms | FAM156A; TMEM29; PP12994; PRO0659; FAM156B; TMEM29B; Protein FAM156A/FAM156B; Transmembrane protein 29/29B |
UniProt ID | Q8NDB6 |
◆ Recombinant Proteins | ||
FAM156A-1577R | Recombinant Rhesus monkey FAM156A Protein, His-tagged | +Inquiry |
RFL13726HF | Recombinant Full Length Human Protein Fam156A(Fam156A) Protein, His-Tagged | +Inquiry |
FAM156A-1402R | Recombinant Rhesus Macaque FAM156A Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM156A-2866H | Recombinant Human FAM156A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAM156A-2903H | Recombinant Human FAM156A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM156A-260HCL | Recombinant Human FAM156A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM156A Products
Required fields are marked with *
My Review for All FAM156A Products
Required fields are marked with *
0
Inquiry Basket