Recombinant Full Length Human Protein Fam134C(Fam134C) Protein, His-Tagged
Cat.No. : | RFL31809HF |
Product Overview : | Recombinant Full Length Human Protein FAM134C(FAM134C) Protein (Q86VR2) (2-466aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-466) |
Form : | Lyophilized powder |
AA Sequence : | AEAEGVPTTPGPASGSTFRGRRDVSGSWERDQQVEAAQRALVEVLGPYEPLLSRVQAALV WERPARSALWCLGLNAAFWFFALTSLRLVFLLAFGLMIIVCIDQWKNKIWPEIKVPRPDA LDNESWGFVHPRLLSVPELCHHVAEVWVSGTIFIRNVLLFKKQNPGKFCLLSCGILTFLA VLGRYVPGLLLSYLMLVTVMMWPLAVYHRLWDRAYVRLKPALQRLDFSVRGYMMSKQRER QLRRRALHPERAMDNHSDSEEELAAFCPQLDDSTVARELAITDSEHSDAEVSCTDNGTFN LSRGQTPLTEGSEDLDGHSDPEESFARDLPDFPSINMDPAGLDDEDDTSIGMPSLMYRSP PGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSGA PAQRATRGFLRSPSSDLDTDAEGDDFELLDQSELSQLDPASSRSH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RETREG3 |
Synonyms | RETREG3; FAM134C; Reticulophagy regulator 3 |
UniProt ID | Q86VR2 |
◆ Recombinant Proteins | ||
EPHB3-4368HF | Recombinant Full Length Human EPHB3 Protein, GST-tagged | +Inquiry |
ECE1-445H | Recombinant Human ECE1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTSW-2119H | Recombinant Human CTSW Protein, GST-tagged | +Inquiry |
RFL1177PF | Recombinant Full Length Pseudomonas Putida Ubiquinol Oxidase Subunit 2(Cyoa) Protein, His-Tagged | +Inquiry |
Agrp-6781M | Recombinant Mouse Agrp protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HBA1-5284H | Native Human Hemoglobin, Alpha 1 | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
M. pneumoniae-28 | Native Mycoplasma pneumoniae Antigen | +Inquiry |
HP-7761R | Native Rabbit Haptoglobin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UPK1A-723HCL | Recombinant Human UPK1A lysate | +Inquiry |
CYP2S1-7108HCL | Recombinant Human CYP2S1 293 Cell Lysate | +Inquiry |
GAB2-6074HCL | Recombinant Human GAB2 293 Cell Lysate | +Inquiry |
C15orf57-8261HCL | Recombinant Human C15orf57 293 Cell Lysate | +Inquiry |
PSKH1-2782HCL | Recombinant Human PSKH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RETREG3 Products
Required fields are marked with *
My Review for All RETREG3 Products
Required fields are marked with *
0
Inquiry Basket