Recombinant Full Length Human Protein Evi2A(Evi2A) Protein, His-Tagged
Cat.No. : | RFL29367HF |
Product Overview : | Recombinant Full Length Human Protein EVI2A(EVI2A) Protein (P22794) (31-236aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (31-236) |
Form : | Lyophilized powder |
AA Sequence : | NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | EVI2A |
Synonyms | EVI2A; EVDA; EVI2; Protein EVI2A; EVI-2A |
UniProt ID | P22794 |
◆ Recombinant Proteins | ||
EVI2A-4375HF | Recombinant Full Length Human EVI2A Protein, GST-tagged | +Inquiry |
Evi2a-12578M | Recombinant Mouse Evi2a, GST-tagged | +Inquiry |
EVI2A-2886M | Recombinant Mouse EVI2A Protein, His (Fc)-Avi-tagged | +Inquiry |
EVI2A-12577H | Recombinant Human EVI2A, His-tagged | +Inquiry |
EVI2A-276H | Recombinant Human EVI2A, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EVI2A-001HCL | Recombinant Human EVI2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EVI2A Products
Required fields are marked with *
My Review for All EVI2A Products
Required fields are marked with *
0
Inquiry Basket