Recombinant Full Length Human EVI2A Protein, GST-tagged

• Cat.No.: EVI2A-4375HF
• Product Overview: Human EVI2A full-length ORF ( AAH35572, 25 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 25-236 amino acids
• Description: EVI2A (Ecotropic Viral Integration Site 2A) is a Protein Coding gene. GO annotations related to this gene include transmembrane signaling receptor activity. An important paralog of this gene is ENSG00000265118.
• Molecular Mass: 49.06 kDa
• AA Sequence: SPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EVI2A ecotropic viral integration site 2A [ Homo sapiens ]
• Official Symbol: EVI2A
• Synonyms: EVI2A; ecotropic viral integration site 2A; EVI2; protein EVI2A; EVDA; ecotropic viral integration site 2A protein homolog; EVI-2A
• Gene ID: 2123
• mRNA Refseq: NM_001003927
• Protein Refseq: NP_001003927
• MIM: 158380
• UniProt ID: P22794