Recombinant Full Length Human Protein Ergic-53(Lman1) Protein, His-Tagged
Cat.No. : | RFL11653HF |
Product Overview : | Recombinant Full Length Human Protein ERGIC-53(LMAN1) Protein (P49257) (31-510aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (31-510) |
Form : | Lyophilized powder |
AA Sequence : | DGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LMAN1 |
Synonyms | LMAN1; ERGIC53; F5F8D; Protein ERGIC-53; ER-Golgi intermediate compartment 53 kDa protein; Gp58; Intracellular mannose-specific lectin MR60; Lectin mannose-binding 1 |
UniProt ID | P49257 |
◆ Recombinant Proteins | ||
LMAN1-1301H | Recombinant Human LMAN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lman1-3796M | Recombinant Mouse Lman1 Protein, Myc/DDK-tagged | +Inquiry |
LMAN1-2528R | Recombinant Rhesus monkey LMAN1 Protein, His-tagged | +Inquiry |
LMAN1-7896H | Recombinant Human LMAN1 protein, His-tagged | +Inquiry |
LMAN1-5107M | Recombinant Mouse LMAN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMAN1-4719HCL | Recombinant Human LMAN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LMAN1 Products
Required fields are marked with *
My Review for All LMAN1 Products
Required fields are marked with *
0
Inquiry Basket