Recombinant Full Length Human Probable G-Protein Coupled Receptor 25(Gpr25) Protein, His-Tagged
Cat.No. : | RFL23074HF |
Product Overview : | Recombinant Full Length Human Probable G-protein coupled receptor 25(GPR25) Protein (O00155) (1-361aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-361) |
Form : | Lyophilized powder |
AA Sequence : | MAPTEPWSPSPGSAPWDYSGLDGLEELELCPAGDLPYGYVYIPALYLAAFAVGLLGNAFV VWLLAGRRGPRRLVDTFVLHLAAADLGFVLTLPLWAAAAALGGRWPFGDGLCKLSSFALA GTRCAGALLLAGMSVDRYLAVVKLLEARPLRTPRCALASCCGVWAVALLAGLPSLVYRGL QPLPGGQDSQCGEEPSHAFQGLSLLLLLLTFVLPLVVTLFCYCRISRRLRRPPHVGRARR NSLRIIFAIESTFVGSWLPFSALRAVFHLARLGALPLPCPLLLALRWGLTIATCLAFVNS CANPLIYLLLDRSFRARALDGACGRTGRLARRISSASSLSRDDSSVFRCRAQAANTASAS W |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPR25 |
Synonyms | GPR25; Probable G-protein coupled receptor 25 |
UniProt ID | O00155 |
◆ Recombinant Proteins | ||
POUV-3770C | Recombinant Chicken POUV | +Inquiry |
AURKA-549H | Recombinant Human Aurora Kinase A, His-tagged | +Inquiry |
RFL19898BF | Recombinant Full Length Bovine Outer Dense Fiber Protein 4(Odf4) Protein, His-Tagged | +Inquiry |
Cd320-320R | Recombinant Rat Cd320 protein(Met1-Ala210), hFc-tagged | +Inquiry |
RFL26532CF | Recombinant Full Length Dog Substance-K Receptor(Tacr2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
LYZ-139C | Native Chicken lysozyme | +Inquiry |
F9-26523TH | Native Human F9 | +Inquiry |
Trf-4782M | Native Mouse Transferrin | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAB39-7912HCL | Recombinant Human CAB39 293 Cell Lysate | +Inquiry |
Brain-535E | Equine Brain whole Lysate, Total Protein | +Inquiry |
CRAT-7293HCL | Recombinant Human CRAT 293 Cell Lysate | +Inquiry |
IDH3A-5305HCL | Recombinant Human IDH3A 293 Cell Lysate | +Inquiry |
CAMLG-7872HCL | Recombinant Human CAMLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR25 Products
Required fields are marked with *
My Review for All GPR25 Products
Required fields are marked with *
0
Inquiry Basket