Recombinant Full Length Human Probable G-Protein Coupled Receptor 21(Gpr21) Protein, His-Tagged
Cat.No. : | RFL25001HF |
Product Overview : | Recombinant Full Length Human Probable G-protein coupled receptor 21(GPR21) Protein (Q99679) (1-349aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-349) |
Form : | Lyophilized powder |
AA Sequence : | MNSTLDGNQSSHPFCLLAFGYLETVNFCLLEVLIIVFLTVLIISGNIIVIFVFHCAPLLN HHTTSYFIQTMAYADLFVGVSCVVPSLSLLHHPLPVEESLTCQIFGFVVSVLKSVSMASL ACISIDRYIAITKPLTYNTLVTPWRLRLCIFLIWLYSTLVFLPSFFHWGKPGYHGDVFQW CAESWHTDSYFTLFIVMMLYAPAALIVCFTYFNIFRICQQHTKDISERQARFSSQSGETG EVQACPDKRYAMVLFRITSVFYILWLPYIIYFLLESSTGHSNRFASFLTTWLAISNSFCN CVIYSLSNSVFQRGLKRLSGAMCTSCASQTTANDPYTVRSKGPLNGCHI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPR21 |
Synonyms | GPR21; Probable G-protein coupled receptor 21 |
UniProt ID | Q99679 |
◆ Recombinant Proteins | ||
EID2B-4396HF | Recombinant Full Length Human EID2B Protein, GST-tagged | +Inquiry |
FKBP9L-4821HF | Recombinant Full Length Human FKBP9L Protein, GST-tagged | +Inquiry |
MGAT1-6205HF | Recombinant Full Length Human MGAT1 Protein, GST-tagged | +Inquiry |
GM1574-6666M | Recombinant Mouse GM1574 Protein | +Inquiry |
Tnfrsf17-661MP | Recombinant Mouse Tnfrsf17 protein, Fc-tagged, R-PE labeled | +Inquiry |
◆ Native Proteins | ||
LRG1-3684H | Native Human LRG1 | +Inquiry |
Lectin-1867W | Active Native Succinylated Wheat Germ Agglutinin Protein | +Inquiry |
VZV-05 | Native Varicella Zoster Virus (VZV) Glycoprotein Antigen | +Inquiry |
FGB-43D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
COL2A1-1648H | Native Human COL2A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IgG3-1606MCL | Recombinant Mouse IgG3 cell lysate | +Inquiry |
CLP1-7435HCL | Recombinant Human CLP1 293 Cell Lysate | +Inquiry |
GBA2-6001HCL | Recombinant Human GBA2 293 Cell Lysate | +Inquiry |
RNF151-2291HCL | Recombinant Human RNF151 293 Cell Lysate | +Inquiry |
BIRC3-8450HCL | Recombinant Human BIRC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR21 Products
Required fields are marked with *
My Review for All GPR21 Products
Required fields are marked with *
0
Inquiry Basket