Recombinant Full Length Human PRKG2 Protein, C-Flag-tagged
Cat.No. : | PRKG2-1299HFL |
Product Overview : | Recombinant Full Length Human PRKG2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that belongs to the serine/threonine protein kinase family of proteins. The encoded protein binds to and inhibits the activation of several receptor tyrosine kinases. The membrane-bound protein is a regulator of intestinal secretion, bone growth and renin secretion. Alternate splicing results in multiple transcript variants encoding distinct isoforms whose regulatory N-termini differ in length but whose C-terminal catalytic domains are identical. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 87.3 kDa |
AA Sequence : | MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTE ELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPP EFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAE GRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNF LRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQ KGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIV DTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACV TEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFS VDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKN GINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Gap junction, Long-term depression, Olfactory transduction |
Full Length : | Full L. |
Gene Name | PRKG2 protein kinase cGMP-dependent 2 [ Homo sapiens (human) ] |
Official Symbol | PRKG2 |
Synonyms | AMD4; PKG2; SMDP; cGK2; cGKII; PRKGR2 |
Gene ID | 5593 |
mRNA Refseq | NM_006259.3 |
Protein Refseq | NP_006250.1 |
MIM | 601591 |
UniProt ID | Q13237 |
◆ Recombinant Proteins | ||
PRKG2-2623H | Recombinant Human PRKG2 Protein, His-tagged | +Inquiry |
PRKG2-6006Z | Recombinant Zebrafish PRKG2 | +Inquiry |
PRKG2-1089H | Recombinant Human Protein Kinase, CGMP-Dependent, Type II, GST-tagged | +Inquiry |
Prkg2-5126M | Recombinant Mouse Prkg2 Protein, Myc/DDK-tagged | +Inquiry |
Prkg2-603R | Recombinant Rat Protein Kinase, cGMP-dependent, Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKG2-2849HCL | Recombinant Human PRKG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRKG2 Products
Required fields are marked with *
My Review for All PRKG2 Products
Required fields are marked with *
0
Inquiry Basket