Recombinant Full Length Human PRKCZ Protein, C-Flag-tagged
Cat.No. : | PRKCZ-57HFL |
Product Overview : | Recombinant Full Length Human PRKCZ Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.5 kDa |
AA Sequence : | MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTV SSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNR RAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETD GIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAM KVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPE EHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLK GFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLT PDDEDAIKRIDQSEFEGFEYINPLLLSTEESVSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Chemokine signaling pathway, Endocytosis, Insulin signaling pathway, Tight junction, Type II diabetes mellitus |
Full Length : | Full L. |
Gene Name | PRKCZ protein kinase C zeta [ Homo sapiens (human) ] |
Official Symbol | PRKCZ |
Synonyms | PKC2; PKC-ZETA |
Gene ID | 5590 |
mRNA Refseq | NM_002744.6 |
Protein Refseq | NP_002735.3 |
MIM | 176982 |
UniProt ID | Q05513 |
◆ Recombinant Proteins | ||
PRKCZ-30179TH | Recombinant Human PRKCZ | +Inquiry |
PRKCZ-1957H | Recombinant Human PRKCZ, GST-tagged | +Inquiry |
PRKCZ-3721H | Recombinant Human PRKCZ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRKCZ-3223Z | Recombinant Zebrafish PRKCZ | +Inquiry |
PRKCZ-409H | Recombinant Full Length Human Protein Kinase C, Zeta, GST-tagged, Active | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKCZ-2852HCL | Recombinant Human PRKCZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRKCZ Products
Required fields are marked with *
My Review for All PRKCZ Products
Required fields are marked with *
0
Inquiry Basket