Recombinant Full Length Human PPP6C Protein
Cat.No. : | PPP6C-400HF |
Product Overview : | Recombinant full length Human PPP6C with N terminal proprietary tag; Predicted MW 59.29 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 305 amino acids |
Description : | This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X. |
Form : | Liquid |
Molecular Mass : | 59.290kDa inclusive of tags |
AA Sequence : | MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESN VQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMG DFVDSGYYSLETFTYLLALKAKWPDRITLLRGNHESRQIT QVYGFYDECQTKYGNANAWRYCTKVLDMLTVAALIDEQIL CVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPE DVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLV HEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTR EPKLFRAVPDSERVIPPRTTTPYFL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PPP6C protein phosphatase 6, catalytic subunit [ Homo sapiens ] |
Official Symbol | PPP6C |
Synonyms | PPP6C; protein phosphatase 6, catalytic subunit; serine/threonine-protein phosphatase 6 catalytic subunit; PP6 |
Gene ID | 5537 |
mRNA Refseq | NM_001123355 |
Protein Refseq | NP_001116827 |
MIM | 612725 |
UniProt ID | O00743 |
◆ Recombinant Proteins | ||
NDUFS7-562H | Recombinant Human NDUFS7 | +Inquiry |
CASP4-1861C | Recombinant Cattle CASP4 protein, His-tagged | +Inquiry |
CDC20-1270R | Recombinant Rat CDC20 Protein | +Inquiry |
Il11ra1-701M | Active Recombinant Mouse Il11ra1, Fc Chimera | +Inquiry |
FAM177A-5540M | Recombinant Mouse FAM177A Protein | +Inquiry |
◆ Native Proteins | ||
TF-31158TH | Native Human TF | +Inquiry |
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
FGA-42D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
MFGE8-8518B | Native Bovine MFGE8, Fluoresence-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIP4-7442HCL | Recombinant Human CLIP4 293 Cell Lysate | +Inquiry |
WFDC2-1266CCL | Recombinant Canine WFDC2 cell lysate | +Inquiry |
KIR3DL1-935HCL | Recombinant Human KIR3DL1 cell lysate | +Inquiry |
LRG1-791HCL | Recombinant Human LRG1 cell lysate | +Inquiry |
SH2D3A-1598HCL | Recombinant Human SH2D3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP6C Products
Required fields are marked with *
My Review for All PPP6C Products
Required fields are marked with *
0
Inquiry Basket