Recombinant Full Length Human PPP2R5A Protein
Cat.No. : | PPP2R5A-394HF |
Product Overview : | Recombinant full length Human PPP2R5A with N-terminal proprietary tag. Predicted MW 79.57kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 486 amino acids |
Description : | The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Alternative transcript variants encoding distinct isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 79.570kDa inclusive of tags |
AA Sequence : | MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQG SSQFRSQGSQAELHPLPQLKDATSNEQQELFCQKLQQCCI LFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQ LVYEFFLRFLESPDFRPSIAKRYIDQKFVQQLLELFDSED PRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMH TAKGLALFHAQLAYCVVQFLEKDTTLTEPVIRGLLKFWPK TCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV SSSHFQVAERALYFWNNEYILSLIEENINKILPIMFASLY KISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYKAE RQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSIL SNTSAE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PPP2R5A protein phosphatase 2, regulatory subunit B, alpha [ Homo sapiens ] |
Official Symbol | PPP2R5A |
Synonyms | PPP2R5A; protein phosphatase 2, regulatory subunit B, alpha; protein phosphatase 2, regulatory subunit B (B56), alpha isoform , protein phosphatase 2, regulatory subunit B, alpha isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit |
Gene ID | 5525 |
mRNA Refseq | NM_001199756 |
Protein Refseq | NP_001186685 |
MIM | 601643 |
UniProt ID | Q15172 |
◆ Recombinant Proteins | ||
SH-RS09720-5422S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS09720 protein, His-tagged | +Inquiry |
CDK8-CCNC-314H | Recombinant Human CDK8/CCNC protein, GST-tagged | +Inquiry |
PRPF18-4376R | Recombinant Rat PRPF18 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH19-332H | Recombinant Human CDH19 protein, GST-tagged | +Inquiry |
RFL22478DF | Recombinant Full Length Drosophila Melanogaster Caax Prenyl Protease 2(Sras) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HPX-207H | Native Human Hemopexin | +Inquiry |
CTSH-190H | Active Native Human Cathepsin H | +Inquiry |
ELANE-001H | Active Native Human ELANE Protein | +Inquiry |
Tnni2-7429M | Native Mouse Tnni2 Protein | +Inquiry |
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST4H4-5510HCL | Recombinant Human HIST4H4 293 Cell Lysate | +Inquiry |
Trachea-543H | Human Trachea Membrane Lysate | +Inquiry |
SNAP91-1639HCL | Recombinant Human SNAP91 293 Cell Lysate | +Inquiry |
Stomach-487H | Human Stomach Membrane Lysate | +Inquiry |
TLR2-001RCL | Recombinant Rat TLR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP2R5A Products
Required fields are marked with *
My Review for All PPP2R5A Products
Required fields are marked with *
0
Inquiry Basket