Recombinant Full Length Human PPP1R2 Protein
Cat.No. : | PPP1R2-391HF |
Product Overview : | Recombinant full length Human Protein phosphatase 1 inhibitor subunit 2 (amino acids 1-205) with N terminal proprietary tag; Predicted MWt 48.62 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 205 amino acids |
Description : | Protein phosphatase inhibitor 2 is an enzyme that in humans is encoded by the PPP1R2 gene. |
Form : | Liquid |
Molecular Mass : | 48.620kDa inclusive of tags |
AA Sequence : | MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEEL SKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMG DDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQE SSGEEDSDLSPEEREKKRQFEMKRKLHYNEGLNIKLARQL ISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQN KLRSS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PPP1R2 protein phosphatase 1, regulatory (inhibitor) subunit 2 [ Homo sapiens ] |
Official Symbol | PPP1R2 |
Synonyms | PPP1R2; protein phosphatase 1, regulatory (inhibitor) subunit 2; protein phosphatase inhibitor 2; IPP2 |
Gene ID | 5504 |
mRNA Refseq | NM_006241 |
Protein Refseq | NP_006232 |
MIM | 601792 |
UniProt ID | P41236 |
◆ Recombinant Proteins | ||
PPP1R2-391HF | Recombinant Full Length Human PPP1R2 Protein | +Inquiry |
PPP1R2-11693Z | Recombinant Zebrafish PPP1R2 | +Inquiry |
PPP1R2-4622R | Recombinant Rat PPP1R2 Protein | +Inquiry |
PPP1R2-13231M | Recombinant Mouse PPP1R2 Protein | +Inquiry |
PPP1R2-4281R | Recombinant Rat PPP1R2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R2-2937HCL | Recombinant Human PPP1R2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1R2 Products
Required fields are marked with *
My Review for All PPP1R2 Products
Required fields are marked with *
0
Inquiry Basket