Recombinant Full Length Human PPP1CB Protein, C-Flag-tagged
Cat.No. : | PPP1CB-755HFL |
Product Overview : | Recombinant Full Length Human PPP1CB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37 kDa |
AA Sequence : | MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECK RRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDK DVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGG MMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Phosphatase |
Protein Pathways : | Focal adhesion, Insulin signaling pathway, Long-term potentiation, Oocyte meiosis, Regulation of actin cytoskeleton, Vascular smooth muscle contraction |
Full Length : | Full L. |
Gene Name | PPP1CB protein phosphatase 1 catalytic subunit beta [ Homo sapiens (human) ] |
Official Symbol | PPP1CB |
Synonyms | MP; PP1B; PP1c; NSLH2; PP-1B; PPP1CD; PP1beta; PPP1beta; HEL-S-80p |
Gene ID | 5500 |
mRNA Refseq | NM_206876.2 |
Protein Refseq | NP_996759.1 |
MIM | 600590 |
UniProt ID | P62140 |
◆ Recombinant Proteins | ||
PPP1CB-4612R | Recombinant Rat PPP1CB Protein | +Inquiry |
PPP1CB-6679C | Recombinant Chicken PPP1CB | +Inquiry |
PPP1CB-2170H | Recombinant Human PPP1CB Protein (2-327 aa), His-tagged | +Inquiry |
PPP1CB-3376R | Recombinant Rhesus Macaque PPP1CB Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1CB-1253Z | Recombinant Zebrafish PPP1CB | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1CB-2949HCL | Recombinant Human PPP1CB 293 Cell Lysate | +Inquiry |
PPP1CB-2950HCL | Recombinant Human PPP1CB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1CB Products
Required fields are marked with *
My Review for All PPP1CB Products
Required fields are marked with *
0
Inquiry Basket