Recombinant Full Length Human PPDPFL Protein, GST-tagged

• Cat.No.: PPDPFL-3921HF
• Product Overview: Human C8orf22 full-length ORF ( ACT64580.1, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 81 amino acids
• Description: Probable regulator of exocrine pancreas development.
• Molecular Mass: 9 kDa
• AA Sequence: MASVPSIGCLLARNQYYRKSSVSSVSSLTSSDSVNFIDDDKPQQGLPEVAESTWWFKSFFHSEPVLSNVRIKDLSATGMNS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PPDPFL pancreatic progenitor cell differentiation and proliferation factor like [ Homo sapiens (human) ]
• Official Symbol: PPDPFL
• Synonyms: C8orf22; PPDPFL; pancreatic progenitor cell differentiation and proliferation factor like; pancreatic progenitor cell differentiation and proliferation factor-like protein; exocrine differentiation and proliferation factor-like protein
• Gene ID: 492307
• mRNA Refseq: NM_001007176
• Protein Refseq: NP_001007177
• UniProt ID: Q8WWR9