Recombinant Full Length Human N4BP2L1 Protein, GST-tagged

• Cat.No.: N4BP2L1-3322HF
• Product Overview: Human CG018 full-length ORF (NP_001073159.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 173 amino acids
• Description: N4BP2L1 (NEDD4 Binding Protein 2 Like 1) is a Protein Coding gene. GO annotations related to this gene include kinase activity. An important paralog of this gene is N4BP2.
• Molecular Mass: 47.1 kDa
• AA Sequence: MEDSFLQSFGRLSLQPQQQQQRQRPPRPPPRGTPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMVFQTEQKNLFRLEMDMVVFRPEMKKHSWCLKRKNPPNERTV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: N4BP2L1 NEDD4 binding protein 2-like 1 [ Homo sapiens ]
• Official Symbol: N4BP2L1
• Synonyms: CG018
• Gene ID: 90634
• mRNA Refseq: NM_052818
• Protein Refseq: NP_438169
• UniProt ID: Q5TBK1