Recombinant Full Length Human POU5F1 protein, His-B2M-tagged

• Cat.No.: POU5F1-3359H
• Product Overview: Recombinant Human POU5F1 protein(Q01860)(1-360aa), fused to N-terminal His-B2M tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&B2M
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 52.6 kDa
• Protein length: 1-360aa
• AA Sequence: MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: POU5F1 POU class 5 homeobox 1 [ Homo sapiens ]
• Official Symbol: POU5F1
• Synonyms: POU5F1; POU class 5 homeobox 1; OTF3, POU domain class 5, transcription factor 1; POU domain, class 5, transcription factor 1; MGC22487; OCT3; Oct4; octamer-binding protein 3; octamer-binding protein 4; POU domain transcription factor OCT4; octamer-binding transcription factor 3; octamer-binding transcription factor-3; POU-type homeodomain-containing DNA-binding protein; OCT4; OTF3; OTF4; OTF-3; Oct-3; Oct-4
• Gene ID: 5460
• mRNA Refseq: NM_001173531
• Protein Refseq: NP_001167002
• MIM: 164177
• UniProt ID: Q01860