Active Recombinant Full Length Human POU5F1 Protein, C-Flag-tagged
Cat.No. : | POU5F1-327HFL |
Product Overview : | Recombinant Full Length Human POU5F1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | EMSA assay |
Molecular Mass : | 38.4 kDa |
AA Sequence : | MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFC GGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIK ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEE ADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCN RRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV TTLGSPMHSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Adult stem cells, Cancer stem cells, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency, Transcription Factors |
Full Length : | Full L. |
Gene Name | POU5F1 POU class 5 homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | POU5F1 |
Synonyms | OCT3; OCT4; OTF3; OTF4; OTF-3; Oct-3; Oct-4; Oct3/4 |
Gene ID | 5460 |
mRNA Refseq | NM_002701.6 |
Protein Refseq | NP_002692.2 |
MIM | 164177 |
UniProt ID | Q01860 |
◆ Recombinant Proteins | ||
POU5F1-113H | Recombinant Human POU5F1 Protein, 11R-tagged | +Inquiry |
POU5F1-327HFL | Active Recombinant Full Length Human POU5F1 Protein, C-Flag-tagged | +Inquiry |
Pou5f1-164M | Recombinant Mouse Pou5f1, Arg-tagged | +Inquiry |
Pou5f1-200M | Recombinant Mouse Pou5f1, TAT-tagged | +Inquiry |
POU5F1-321H | Recombinant Human POU5F1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POU5F1-2999HCL | Recombinant Human POU5F1 293 Cell Lysate | +Inquiry |
POU5F1-3000HCL | Recombinant Human POU5F1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POU5F1 Products
Required fields are marked with *
My Review for All POU5F1 Products
Required fields are marked with *
0
Inquiry Basket