Recombinant Full Length Human Potassium Voltage-Gated Channel Subfamily G Member 2(Kcng2) Protein, His-Tagged
Cat.No. : | RFL2199HF |
Product Overview : | Recombinant Full Length Human Potassium voltage-gated channel subfamily G member 2(KCNG2) Protein (Q9UJ96) (1-466aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-466) |
Form : | Lyophilized powder |
AA Sequence : | MEPWPCSPGGGGGTRARHVIINVGGCRVRLAWAALARCPLARLERLRACRGHDDLLRVCD DYDVSRDEFFFDRSPCAFRAIVALLRAGKLRLLRGPCALAFRDELAYWGIDEARLERCCL RRLRRREEEAAEARAGPTERGAQGSPARALGPRGRLQRGRRRLRDVVDNPHSGLAGKLFA CVSVSFVAVTAVGLCLSTMPDIRAEEERGECSPKCRSLFVLETVCVAWFSFEFLLRSLQA ESKCAFLRAPLNIIDILALLPFYVSLLLGLAAGPGGTKLLERAGLVLRLLRALRVLYVMR LARHSLGLRSLGLTMRRCAREFGLLLLFLCVAMALFAPLVHLAERELGARRDFSSVPASY WWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQQ RAASPEPALQEDSTHSATATEDSSQGPDSAGLADDSADALWVRAGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNG2 |
Synonyms | KCNG2; KCNF2; Potassium voltage-gated channel subfamily G member 2; Cardiac potassium channel subunit; Voltage-gated potassium channel subunit Kv6.2 |
UniProt ID | Q9UJ96 |
◆ Native Proteins | ||
PLD-18A | Active Native Arachis hypogaea (peanut) Phospholipase D, Type II | +Inquiry |
PeptideD-724E | Native Ebola virus Delta Peptide | +Inquiry |
Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
HYAL1-39B | Active Native Bovine Hyaluronidase | +Inquiry |
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDIPT-7634HCL | Recombinant Human CDIPT 293 Cell Lysate | +Inquiry |
OGN-3590HCL | Recombinant Human OGN 293 Cell Lysate | +Inquiry |
HIBCH-5565HCL | Recombinant Human HIBCH 293 Cell Lysate | +Inquiry |
RER1-2419HCL | Recombinant Human RER1 293 Cell Lysate | +Inquiry |
JAM3-1074HCL | Recombinant Human JAM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNG2 Products
Required fields are marked with *
My Review for All KCNG2 Products
Required fields are marked with *
0
Inquiry Basket