Recombinant Full Length Chicken Potassium Voltage-Gated Channel Subfamily G Member 2(Kcng2) Protein, His-Tagged
Cat.No. : | RFL21577GF |
Product Overview : | Recombinant Full Length Chicken Potassium voltage-gated channel subfamily G member 2(KCNG2) Protein (O73606) (1-518aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-518) |
Form : | Lyophilized powder |
AA Sequence : | MALLTGNADRAFSSYSFNKLENLCEVQTKKGFFYRKAKLLHPDEDLCYLARLDDRTRFVI INVGGIKYKVPWTTLENCPLTRLGKLKSCNNYDEIMNICDDYDVSCNEFFFDRNPSAFRT IMTFLTAGKLRLLREMCALSFQEELVYWGIEEDHLEWCCKKRLQQKEEEAAEARMYEGEM MFSETTQCAFQDNNWLSLCMRNLRDMVENPHSGIPGKIFACISISFVAITAVSLCISTMP DVREEEDRGECSQKCYDIFVLETVCVAWFSFEFLLRSIQAENKCAFLKTPLNIIDILAIL PFYISLIVDMASTKNSSKPGGGAGNKYLERVGLVLRFLRALRILYVMRLARHSLGLQTLG LTVRRCTREFGLLLLFLCVAMALFSPLVYLAESELGAKQEFTSIPTSYWWAVISMTTVGY GDMVPRSIPGQVVALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQQRAASRQMHQLEE STKLAGGGSSQWITAASPPDAAREDGRPELDQEAKRSC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNG2 |
Synonyms | KCNG2; Potassium voltage-gated channel subfamily G member 2; Potassium channel cKv6.2; Voltage-gated potassium channel subunit Kv6.2 |
UniProt ID | O73606 |
◆ Recombinant Proteins | ||
RFL12510HF | Recombinant Full Length Helianthus Annuus Cytochrome C Oxidase Subunit 3(Cox3) Protein, His-Tagged | +Inquiry |
POLR3A-1639C | Recombinant Chicken POLR3A | +Inquiry |
SLC30A3-6584H | Recombinant Human SLC30A3 Protein (Arg286-Pro386), His tagged | +Inquiry |
HSD11B1-0320H | Recombinant Human HSD11B1 Protein (M1-K292), His/Strep tagged | +Inquiry |
HSP90AA1-318H | Recombinant Human Heat Shock Protein 90kDa Alpha (Cytosolic), Class A Member 1 | +Inquiry |
◆ Native Proteins | ||
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
HBA2-27784TH | Native Human HBA2 | +Inquiry |
IgM-208M | Native Monkey Immunoglobulin M | +Inquiry |
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
Cpn-33 | Native Premium Chlamydia pneumoniae Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spleen-474R | Rhesus monkey Spleen Membrane Lysate | +Inquiry |
CMA1-493HCL | Recombinant Human CMA1 cell lysate | +Inquiry |
ZDHHC7-192HCL | Recombinant Human ZDHHC7 293 Cell Lysate | +Inquiry |
PLD3-3122HCL | Recombinant Human PLD3 293 Cell Lysate | +Inquiry |
IKZF2-5252HCL | Recombinant Human IKZF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNG2 Products
Required fields are marked with *
My Review for All KCNG2 Products
Required fields are marked with *
0
Inquiry Basket