Recombinant Full Length Human Potassium Voltage-Gated Channel Subfamily C Member 1(Kcnc1) Protein, His-Tagged
Cat.No. : | RFL17253HF |
Product Overview : | Recombinant Full Length Human Potassium voltage-gated channel subfamily C member 1(KCNC1) Protein (P48547) (1-511aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-511) |
Form : | Lyophilized powder |
AA Sequence : | MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD SFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE TEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFA TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH HSTQSDTCPLAQEEILEINRAGRKPLRGMSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNC1 |
Synonyms | KCNC1; Potassium voltage-gated channel subfamily C member 1; NGK2; Voltage-gated potassium channel subunit Kv3.1; Voltage-gated potassium channel subunit Kv4 |
UniProt ID | P48547 |
◆ Native Proteins | ||
Peroxidase-32H | Active Native Horseradish Peroxidase | +Inquiry |
FTH1-28156TH | Native Human FTH1 | +Inquiry |
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
MG-202H | Native Human Menopausal Gonadotropin | +Inquiry |
Protein C-89H | Native Human Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCDHA10-3397HCL | Recombinant Human PCDHA10 293 Cell Lysate | +Inquiry |
EGLN2-6694HCL | Recombinant Human EGLN2 293 Cell Lysate | +Inquiry |
ADCYAP1-9019HCL | Recombinant Human ADCYAP1 293 Cell Lysate | +Inquiry |
RNF168-1520HCL | Recombinant Human RNF168 cell lysate | +Inquiry |
CNPY2-1221HCL | Recombinant Human CNPY2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KCNC1 Products
Required fields are marked with *
My Review for All KCNC1 Products
Required fields are marked with *
0
Inquiry Basket