Recombinant Full Length Human Potassium Channel Subfamily K Member 18(Kcnk18) Protein, His-Tagged
Cat.No. : | RFL7592HF |
Product Overview : | Recombinant Full Length Human Potassium channel subfamily K member 18(KCNK18) Protein (Q7Z418) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MEVSGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVVFSAIEDGQVLVAADDGEFEK FLEELCRILNCSETVVEDRKQDLQGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYG YIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKFPFFTRPLLSKW CPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTL QLPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAI LPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEIVFIAFKLVQN RLIDIYKNVMLFFAKGKFYHLVKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNK18 |
Synonyms | KCNK18; TRESK; TRIK; Potassium channel subfamily K member 18; TWIK-related individual potassium channel; TWIK-related spinal cord potassium channel |
UniProt ID | Q7Z418 |
◆ Recombinant Proteins | ||
MPN-1130M | Recombinant Mycoplasma pneumoniae MPN protein, His&Myc-tagged | +Inquiry |
HDAC3-550H | Recombinant Human HDAC3 Protein (1-428 aa), His-SUMO-tagged | +Inquiry |
HA-436H | Active Recombinant H5N1 HA, His-tagged | +Inquiry |
MVP-5381H | Recombinant Human MVP Protein (Ala2-Pro272), N-His tagged | +Inquiry |
MADCAM1-30133H | Recombinant Human MADCAM1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GFAP-171B | Native bovine GFAP | +Inquiry |
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
Collagen-326H | Native Human Collagen Type III | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAK2-1276HCL | Recombinant Human PAK2 cell lysate | +Inquiry |
QPCT-001HCL | Recombinant Human QPCT cell lysate | +Inquiry |
BAHD1-8524HCL | Recombinant Human BAHD1 293 Cell Lysate | +Inquiry |
RALY-2540HCL | Recombinant Human RALY 293 Cell Lysate | +Inquiry |
TMEM19-682HCL | Recombinant Human TMEM19 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNK18 Products
Required fields are marked with *
My Review for All KCNK18 Products
Required fields are marked with *
0
Inquiry Basket