Recombinant Full Length Human PLXDC1 Protein, C-Flag-tagged
Cat.No. : | PLXDC1-874HFL |
Product Overview : | Recombinant Full Length Human PLXDC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be involved in angiogenesis and spinal cord development. Part of receptor complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.6 kDa |
AA Sequence : | MRGELWLLVLVLREAARALSPQPGAGHDEGPGSGWAAKGTVRGWNRRARESPGHVSEPDRTQLSQDLGGG TLAMDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHTILSNTHRQASRVVLSFD FPFYGHPLRQITMATGGFIFMGDVIHRMLTATQYVAPLMANFNPGYSDNSTVVYFDNGTVFVVQWDHVYL QGWEDKGSFTFQAALHHDGRIVFAYKEIPMSVPEISSSQHPVKTGLSDAFMILNPSPDVPESRRRSIFEY HRIELDPSKVTSMSAVEFTPLPTCLQHRSCDACMSSDLTFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQE AEGRMCEDFQDEDHDSASPDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTKGT PVHLGTIVGIVLAVLLVAAIILAGIYINGHPTSNAALFFIERRPHHWPAMKFRSHPDHSTYAEVEPSGHE KEGFMEAEQCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | PLXDC1 plexin domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | PLXDC1 |
Synonyms | TEM3; TEM7 |
Gene ID | 57125 |
mRNA Refseq | NM_020405.5 |
Protein Refseq | NP_065138.2 |
MIM | 606826 |
UniProt ID | Q8IUK5 |
◆ Recombinant Proteins | ||
PLXDC1-12996M | Recombinant Mouse PLXDC1 Protein | +Inquiry |
PLXDC1-5034H | Recombinant Human PLXDC1 Protein, His-tagged | +Inquiry |
PLXDC1-2157H | Recombinant Human PLXDC1 Protein, MYC/DDK-tagged | +Inquiry |
Plxdc1-4946M | Recombinant Mouse Plxdc1 Protein, Myc/DDK-tagged | +Inquiry |
PLXDC1-3784H | Recombinant Human PLXDC1, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLXDC1-1912HCL | Recombinant Human PLXDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLXDC1 Products
Required fields are marked with *
My Review for All PLXDC1 Products
Required fields are marked with *
0
Inquiry Basket