Recombinant Full Length Human PLEKHS1 Protein, GST-tagged
Cat.No. : | PLEKHS1-1784HF |
Product Overview : | Human PLEKHS1 full-length ORF ( AAH36365, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 282 amino acids |
Description : | PLEKHS1 (Pleckstrin Homology Domain Containing S1) is a Protein Coding gene. Diseases associated with PLEKHS1 include Ureter, Cancer Of. An important paralog of this gene is GAB2. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 56.76 kDa |
AA Sequence : | MEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPRRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PLEKHS1 pleckstrin homology domain containing S1 [ Homo sapiens (human) ] |
Official Symbol | PLEKHS1 |
Synonyms | C10ORF81; chromosome 10 open reading frame 81; PH domain-containing protein C10orf81; bA211N11.2; FLJ23537; epididymis luminal protein 185; HEL185; RP11-211N11.2 |
Gene ID | 79949 |
mRNA Refseq | NM_001193434 |
Protein Refseq | NP_001180363 |
UniProt ID | Q5SXH7 |
◆ Recombinant Proteins | ||
Plekhs1-1443M | Recombinant Mouse Plekhs1 Protein, Myc/DDK-tagged | +Inquiry |
PLEKHS1-1784HF | Recombinant Full Length Human PLEKHS1 Protein, GST-tagged | +Inquiry |
PLEKHS1-6437Z | Recombinant Zebrafish PLEKHS1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLEKHS1 Products
Required fields are marked with *
My Review for All PLEKHS1 Products
Required fields are marked with *
0
Inquiry Basket