Recombinant Full Length Human PLEKHS1 Protein, GST-tagged

• Cat.No.: PLEKHS1-1784HF
• Product Overview: Human PLEKHS1 full-length ORF ( AAH36365, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: PLEKHS1 (Pleckstrin Homology Domain Containing S1) is a Protein Coding gene. Diseases associated with PLEKHS1 include Ureter, Cancer Of. An important paralog of this gene is GAB2.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 56.76 kDa
• Protein length: 282 amino acids
• AA Sequence: MEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSVLLELDNIIASSDSGESIETDGPDQVSGRIECHYEPMESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQEQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLSILINNIPDESQVEKLNVFLSPPDVINYLALTEATGRICVSQWEGPRRLGCIFCHGDHLLAVNDLKPQSLEEVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMCPSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGARE
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PLEKHS1 pleckstrin homology domain containing S1 [ Homo sapiens (human) ]
• Official Symbol: PLEKHS1
• Synonyms: C10ORF81; chromosome 10 open reading frame 81; PH domain-containing protein C10orf81; bA211N11.2; FLJ23537; epididymis luminal protein 185; HEL185; RP11-211N11.2
• Gene ID: 79949
• mRNA Refseq: NM_001193434
• Protein Refseq: NP_001180363
• UniProt ID: Q5SXH7