Recombinant Full Length Human PLCXD1 Protein, C-Flag-tagged

• Cat.No.: PLCXD1-2096HFL
• Product Overview: Recombinant Full Length Human PLCXD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene is the most terminal protein-coding gene in the pseudoautosomal (PAR) region on chromosomes X and Y. Alternate splicing results in multiple transcript variants.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 36.5 kDa
• AA Sequence: MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLN KALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEW LERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRR HHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRL SAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: PLCXD1 phosphatidylinositol specific phospholipase C X domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: PLCXD1
• Synonyms: LL0XNC01-136G2.1
• Gene ID: 55344
• mRNA Refseq: NM_018390.4
• Protein Refseq: NP_060860.1
• MIM: 300974
• UniProt ID: Q9NUJ7