Recombinant Full Length Human PLAAT3 Protein, C-Flag-tagged
Cat.No. : | PLAAT3-373HFL |
Product Overview : | Recombinant Full Length Human PLAAT3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables N-acyltransferase activity; phospholipase A1 activity; and phospholipase A2 activity. Involved in N-acylphosphatidylethanolamine metabolic process. Predicted to be located in several cellular components, including lysosome; nuclear envelope; and peroxisome. Predicted to be active in cytoplasm. Biomarker of seminoma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.8 kDa |
AA Sequence : | MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA GMGLAAMSLIGVMFSRNKRQKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | PLAAT3 phospholipase A and acyltransferase 3 [ Homo sapiens (human) ] |
Official Symbol | PLAAT3 |
Synonyms | AdPLA; HRSL3; HRASLS3; HREV107; PLA2G16; PLAAT-3; H-REV107; HREV107-1; HREV107-3; H-REV107-1 |
Gene ID | 11145 |
mRNA Refseq | NM_007069.3 |
Protein Refseq | NP_009000.2 |
MIM | 613867 |
UniProt ID | P53816 |
◆ Recombinant Proteins | ||
EIF4EBP2-4999H | Recombinant Human Eukaryotic Translation Initiation Factor 4E Binding Protein 2, His-tagged | +Inquiry |
POLR2J-801H | Recombinant Human POLR2J Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL30531BF | Recombinant Full Length Brucella Ovis Atp Synthase Subunit B 1(Atpf1) Protein, His-Tagged | +Inquiry |
EFCC1-5186H | Recombinant Human EFCC1 Protein, GST-tagged | +Inquiry |
GSTP1-3514H | Recombinant Human GSTP1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
C3-8391H | Native Human C3 | +Inquiry |
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
GC-196H | Native Human Globulins Cohn fraction IV-4 protein | +Inquiry |
Stomach-004H | Human Stomach Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SKOV-3-1612H | SKOV-3 (human adenocarcinoma) nuclear extract lysate | +Inquiry |
LIFR-2285MCL | Recombinant Mouse LIFR cell lysate | +Inquiry |
Thymus-657B | Bovine Thymus Lysate, Total Protein | +Inquiry |
ECHS1-528HCL | Recombinant Human ECHS1 cell lysate | +Inquiry |
FLT3LG-1387MCL | Recombinant Mouse FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLAAT3 Products
Required fields are marked with *
My Review for All PLAAT3 Products
Required fields are marked with *
0
Inquiry Basket