Recombinant Full Length Human PLAAT3 Protein, C-Flag-tagged

Cat.No. : PLAAT3-373HFL
Product Overview : Recombinant Full Length Human PLAAT3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables N-acyltransferase activity; phospholipase A1 activity; and phospholipase A2 activity. Involved in N-acylphosphatidylethanolamine metabolic process. Predicted to be located in several cellular components, including lysosome; nuclear envelope; and peroxisome. Predicted to be active in cytoplasm. Biomarker of seminoma.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 17.8 kDa
AA Sequence : MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA
GMGLAAMSLIGVMFSRNKRQKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Transmembrane
Full Length : Full L.
Gene Name PLAAT3 phospholipase A and acyltransferase 3 [ Homo sapiens (human) ]
Official Symbol PLAAT3
Synonyms AdPLA; HRSL3; HRASLS3; HREV107; PLA2G16; PLAAT-3; H-REV107; HREV107-1; HREV107-3; H-REV107-1
Gene ID 11145
mRNA Refseq NM_007069.3
Protein Refseq NP_009000.2
MIM 613867
UniProt ID P53816

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PLAAT3 Products

Required fields are marked with *

My Review for All PLAAT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon