Recombinant Full Length Human PITX1 Protein
Cat.No. : | PITX1-372HF |
Product Overview : | Recombinant full length Human PITX1 with N terminal proprietary tag; Predicted MW 60.61kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 314 amino acids |
Description : | This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. |
Form : | Liquid |
Molecular Mass : | 60.610kDa inclusive of tags |
AA Sequence : | MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPR EPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGA DDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMRE EIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGY VPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFT FFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNS GLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNS SLASLRLKSKQHSSFGYGALQGPASGLNACQYNS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PITX1 paired-like homeodomain 1 [ Homo sapiens ] |
Official Symbol | PITX1 |
Synonyms | PITX1; paired-like homeodomain 1; BFT, paired like homeodomain transcription factor 1; pituitary homeobox 1; POTX; PTX1 |
Gene ID | 5307 |
mRNA Refseq | NM_002653 |
Protein Refseq | NP_002644 |
MIM | 602149 |
UniProt ID | P78337 |
◆ Recombinant Proteins | ||
RFL9736PF | Recombinant Full Length Pseudomonas Stutzeri Undecaprenyl-Diphosphatase 1(Uppp1) Protein, His-Tagged | +Inquiry |
Benzonase Nuclease-0747S | Recombinant Serratia marcescens Benzonase Nuclease Protein | +Inquiry |
FAM170A-1299H | Recombinant Human FAM170A Protein, His-tagged | +Inquiry |
GLO1-293C | Recombinant Cynomolgus Monkey GLO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TEX2-5749Z | Recombinant Zebrafish TEX2 | +Inquiry |
◆ Native Proteins | ||
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
CTSG-26490TH | Native Human CTSG | +Inquiry |
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
CST3-26152TH | Native Human CST3 | +Inquiry |
Chitin-001C | Native Crawfish Chitin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNC1LI1-6762HCL | Recombinant Human DYNC1LI1 293 Cell Lysate | +Inquiry |
FN3KRP-6176HCL | Recombinant Human FN3KRP 293 Cell Lysate | +Inquiry |
FAM82A2-6346HCL | Recombinant Human FAM82A2 293 Cell Lysate | +Inquiry |
UBE2C-591HCL | Recombinant Human UBE2C 293 Cell Lysate | +Inquiry |
PHF6-3225HCL | Recombinant Human PHF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PITX1 Products
Required fields are marked with *
My Review for All PITX1 Products
Required fields are marked with *
0
Inquiry Basket