Recombinant Full Length Human PIPOX Protein, C-Flag-tagged

• Cat.No.: PIPOX-1184HFL
• Product Overview: Recombinant Full Length Human PIPOX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables L-pipecolate oxidase activity and sarcosine oxidase activity. Involved in L-lysine catabolic process to acetyl-CoA via L-pipecolate. Located in peroxisome.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 43.9 kDa
• AA Sequence: MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLEDFYTRMMHE CYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVG LLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVITAGPWTNQLL RPLGIEMPLQTLRINVCYWREMVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADP EERDCPTARTDIGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG
  FKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLGKAHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transmembrane
• Protein Pathways: Glycine, serine and threonine metabolism, Lysine degradation, Metabolic pathways
• Full Length: Full L.

Gene Information

• Gene Name: PIPOX pipecolic acid and sarcosine oxidase [ Homo sapiens (human) ]
• Official Symbol: PIPOX
• Synonyms: LPIPOX
• Gene ID: 51268
• mRNA Refseq: NM_016518.3
• Protein Refseq: NP_057602.2
• MIM: 616713
• UniProt ID: Q9P0Z9