Recombinant Full Length Human PIM1 Protein, C-Flag-tagged
Cat.No. : | PIM1-959HFL |
Product Overview : | Recombinant Full Length Human PIM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in prostate cancer. It plays a role in signal transduction in blood cells, contributing to both cell proliferation and survival, and thus provides a selective advantage in tumorigenesis. Both the human and orthologous mouse genes have been reported to encode two isoforms (with preferential cellular localization) resulting from the use of alternative in-frame translation initiation codons, the upstream non-AUG (CUG) and downstream AUG codons. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.5 kDa |
AA Sequence : | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVE KDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQ EELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPP EWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPT FEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase |
Protein Pathways : | Acute myeloid leukemia, Jak-STAT signaling pathway |
Full Length : | Full L. |
Gene Name | PIM1 Pim-1 proto-oncogene, serine/threonine kinase [ Homo sapiens (human) ] |
Official Symbol | PIM1 |
Synonyms | PIM |
Gene ID | 5292 |
mRNA Refseq | NM_002648.4 |
Protein Refseq | NP_002639.1 |
MIM | 164960 |
UniProt ID | P11309 |
◆ Recombinant Proteins | ||
PIM1-9086Z | Recombinant Zebrafish PIM1 | +Inquiry |
PIM1-1288H | Recombinant Human Pim-1 Oncogene, His-tagged | +Inquiry |
Pim1-7907M | Recombinant Mouse Pim1 protein, His-tagged | +Inquiry |
PIM1-4899H | Recombinant Human PIM1 Protein (Ser98-Lys313), N-His tagged | +Inquiry |
PIM1-959HFL | Recombinant Full Length Human PIM1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIM1-3181HCL | Recombinant Human PIM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIM1 Products
Required fields are marked with *
My Review for All PIM1 Products
Required fields are marked with *
0
Inquiry Basket