Recombinant Full Length Human Phospholipase D4(Pld4) Protein, His-Tagged
Cat.No. : | RFL22610HF |
Product Overview : | Recombinant Full Length Human Phospholipase D4(PLD4) Protein (Q96BZ4) (1-506aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-506) |
Form : | Lyophilized powder |
AA Sequence : | MLKPLWKAAVAPTWPCSMPPRRPWDREAGTLQVLGALAVLWLGSVALICLLWQVPRPPTW GQVQPKDVPRSWEHGSSPAWEPLEAEARQQRDSCQLVLVESIPQDLPSAAGSPSAQPLGQ AWLQLLDTAQESVHVASYYWSLTGPDIGVNDSSSQLGEALLQKLQQLLGRNISLAVATSS PTLARTSTDLQVLAARGAHVRQVPMGRLTRGVLHSKFWVVDGRHIYMGSANMDWRSLTQV KELGAVIYNCSHLAQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVP TTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFPTTRFSHPPRYWPVLDN ALRAAAFGKGVRVRLLVGCGLNTDPTMFPYLRSLQALSNPAANVSVDVKVFIVPVGNHSN IPFSRVNHSKFMVTEKAAYIGTSNWSEDYFSSTAGVGLVVTQSPGAQPAGATVQEQLRQL FERDWSSRYAVGLDGQAPGQDCVWQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PLD4 |
Synonyms | C14orf175; Choline phosphatase 4; EC 3.1.4.4; Phosphatidylcholine hydrolyzing phospholipase D4; Phosphatidylcholine-hydrolyzing phospholipase D4; Phospholipase D family member 4; Phospholipase D4; PLD 4; PLD4; PLD4_HUMAN |
UniProt ID | Q96BZ4 |
◆ Recombinant Proteins | ||
VTG2-1291C | Recombinant Chicken VTG2 Protein (26-653 aa), His-tagged | +Inquiry |
LGR6-559H | Recombinant Human LGR6, His-tagged | +Inquiry |
Lgals12-445R | Recombinant Rat Lgals12 Protein, His-tagged | +Inquiry |
OR6Q1-3764H | Recombinant Human OR6Q1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL15571ZF | Recombinant Full Length Zygnema Circumcarinatum Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
A2M-01H | Native Human A2M Protein | +Inquiry |
LLC-231H | Native Human Lambda Light Chain | +Inquiry |
Troponin-16R | Native Rabbit Skeletal Muscle Troponin ITC Complex | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
Collagen-59C | Native Chicken Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNPPD1-8086HCL | Recombinant Human C2orf24 293 Cell Lysate | +Inquiry |
RAD18-2561HCL | Recombinant Human RAD18 293 Cell Lysate | +Inquiry |
GP1BB-2588HCL | Recombinant Human GP1BB cell lysate | +Inquiry |
ITGA3-5134HCL | Recombinant Human ITGA3 293 Cell Lysate | +Inquiry |
ZAK-224HCL | Recombinant Human ZAK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PLD4 Products
Required fields are marked with *
My Review for All PLD4 Products
Required fields are marked with *
0
Inquiry Basket