Recombinant Full Length Human Phospholipase D4(Pld4) Protein, His-Tagged
Cat.No. : | RFL22610HF |
Product Overview : | Recombinant Full Length Human Phospholipase D4(PLD4) Protein (Q96BZ4) (1-506aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-506) |
Form : | Lyophilized powder |
AA Sequence : | MLKPLWKAAVAPTWPCSMPPRRPWDREAGTLQVLGALAVLWLGSVALICLLWQVPRPPTW GQVQPKDVPRSWEHGSSPAWEPLEAEARQQRDSCQLVLVESIPQDLPSAAGSPSAQPLGQ AWLQLLDTAQESVHVASYYWSLTGPDIGVNDSSSQLGEALLQKLQQLLGRNISLAVATSS PTLARTSTDLQVLAARGAHVRQVPMGRLTRGVLHSKFWVVDGRHIYMGSANMDWRSLTQV KELGAVIYNCSHLAQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVP TTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFPTTRFSHPPRYWPVLDN ALRAAAFGKGVRVRLLVGCGLNTDPTMFPYLRSLQALSNPAANVSVDVKVFIVPVGNHSN IPFSRVNHSKFMVTEKAAYIGTSNWSEDYFSSTAGVGLVVTQSPGAQPAGATVQEQLRQL FERDWSSRYAVGLDGQAPGQDCVWQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PLD4 |
Synonyms | C14orf175; Choline phosphatase 4; EC 3.1.4.4; Phosphatidylcholine hydrolyzing phospholipase D4; Phosphatidylcholine-hydrolyzing phospholipase D4; Phospholipase D family member 4; Phospholipase D4; PLD 4; PLD4; PLD4_HUMAN |
UniProt ID | Q96BZ4 |
◆ Recombinant Proteins | ||
PLD4-5743H | Recombinant Human PLD4 protein, His-tagged | +Inquiry |
Pld4-6844M | Recombinant Mouse Pld4 protein, His-tagged | +Inquiry |
RFL5783MF | Recombinant Full Length Mouse Phospholipase D4(Pld4) Protein, His-Tagged | +Inquiry |
PLD4-1079H | Recombinant Human PLD4 Protein (52-506 aa), His-SUMO-tagged | +Inquiry |
RFL22610HF | Recombinant Full Length Human Phospholipase D4(Pld4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLD4-3121HCL | Recombinant Human PLD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLD4 Products
Required fields are marked with *
My Review for All PLD4 Products
Required fields are marked with *
0
Inquiry Basket