Recombinant Full Length Human PGD Protein, C-Flag-tagged
Cat.No. : | PGD-2048HFL |
Product Overview : | Recombinant Full Length Human PGD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | 6-phosphogluconate dehydrogenase is the second dehydrogenase in the pentose phosphate shunt. Deficiency of this enzyme is generally asymptomatic, and the inheritance of this disorder is autosomal dominant. Hemolysis results from combined deficiency of 6-phosphogluconate dehydrogenase and 6-phosphogluconolactonase suggesting a synergism of the two enzymopathies. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53 kDa |
AA Sequence : | MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRR IILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPS LMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLG MAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTL IGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFG WTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Glutathione metabolism, Metabolic pathways, Pentose phosphate pathway |
Full Length : | Full L. |
Gene Name | PGD phosphogluconate dehydrogenase [ Homo sapiens (human) ] |
Official Symbol | PGD |
Synonyms | 6PGD |
Gene ID | 5226 |
mRNA Refseq | NM_002631.4 |
Protein Refseq | NP_002622.2 |
MIM | 172200 |
UniProt ID | P52209 |
◆ Recombinant Proteins | ||
PGD-393H | Active Recombinant Human PGD Protein, His-tagged | +Inquiry |
PGD-4881H | Recombinant Human PGD Protein (Met1-Ala483), C-His tagged | +Inquiry |
PGD-0258H | Recombinant Human PGD Protein (M1-A483), Tag Free | +Inquiry |
PGD-0259H | Recombinant Human PGD Protein (M1-A483), His/Strep tagged | +Inquiry |
PGD-1665H | Recombinant Human PGD, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGD-3257HCL | Recombinant Human PGD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGD Products
Required fields are marked with *
My Review for All PGD Products
Required fields are marked with *
0
Inquiry Basket