Recombinant Full Length Human PDCD6IP Protein, C-Flag-tagged
Cat.No. : | PDCD6IP-398HFL |
Product Overview : | Recombinant Full Length Human PDCD6IP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding. Studies using mouse cells have shown that overexpression of this protein can block apoptosis. In addition, the product of this gene binds to the product of the PDCD6 gene, a protein required for apoptosis, in a calcium-dependent manner. This gene product also binds to endophilins, proteins that regulate membrane shape during endocytosis. Overexpression of this gene product and endophilins results in cytoplasmic vacuolization, which may be partly responsible for the protection against cell death. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have been identified on chromosome 15. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 95.8 kDa |
AA Sequence : | MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLR YYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNL DNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKD AIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHA AELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQK FTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK SRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRA EGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLD EVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQ VSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKT ERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPS ATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQS PGQAPYPGPQQPSYPFPQPPQQSYYPQQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Endocytosis |
Full Length : | Full L. |
Gene Name | PDCD6IP programmed cell death 6 interacting protein [ Homo sapiens (human) ] |
Official Symbol | PDCD6IP |
Synonyms | AIP1; ALIX; HP95; DRIP4; MCPH29 |
Gene ID | 10015 |
mRNA Refseq | NM_013374.6 |
Protein Refseq | NP_037506.2 |
MIM | 608074 |
UniProt ID | Q8WUM4 |
◆ Recombinant Proteins | ||
PDCD6IP-3852H | Recombinant Human PDCD6IP Protein (Glu174-Ala383), N-GST tagged | +Inquiry |
PDCD6IP-4321R | Recombinant Rat PDCD6IP Protein | +Inquiry |
PDCD6IP-2793H | Recombinant Human PDCD6IP protein(402-652aa), His-tagged | +Inquiry |
PDCD6IP-1938H | Recombinant Human PDCD6IP, His-tagged | +Inquiry |
ADAM12-1933H | Recombinant Human ADAM12 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDCD6IP-3358HCL | Recombinant Human PDCD6IP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDCD6IP Products
Required fields are marked with *
My Review for All PDCD6IP Products
Required fields are marked with *
0
Inquiry Basket