Recombinant Full Length Human PDCD1LG2 Protein, C-Flag-tagged

• Cat.No.: PDCD1LG2-1020HFL
• Product Overview: Recombinant Full Length Human PDCD1LG2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: Involved in negative regulation of activated T cell proliferation; negative regulation of interferon-gamma production; and negative regulation of interleukin-10 production. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Biomarker of pulmonary tuberculosis.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 30.8 kDa
• AA Sequence: MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ
  SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs)
• Full Length: Full L.

Gene Information

• Gene Name: PDCD1LG2 programmed cell death 1 ligand 2 [ Homo sapiens (human) ]
• Official Symbol: PDCD1LG2
• Synonyms: B7DC; Btdc; PDL2; CD273; PD-L2; PDCD1L2; bA574F11.2
• Gene ID: 80380
• mRNA Refseq: NM_025239.4
• Protein Refseq: NP_079515.2
• MIM: 605723
• UniProt ID: Q9BQ51