Recombinant Full Length Human PCNA Protein, C-Flag-tagged
Cat.No. : | PCNA-249HFL |
Product Overview : | Recombinant Full Length Human PCNA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.6 kDa |
AA Sequence : | MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGV NLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMP SGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALR YLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | Base excision repair, Cell cycle, DNA replication, Mismatch repair, Nucleotide excision repair |
Full Length : | Full L. |
Gene Name | PCNA proliferating cell nuclear antigen [ Homo sapiens (human) ] |
Official Symbol | PCNA |
Synonyms | ATLD2 |
Gene ID | 5111 |
mRNA Refseq | NM_002592.2 |
Protein Refseq | NP_002583.1 |
MIM | 176740 |
UniProt ID | P12004 |
◆ Recombinant Proteins | ||
PCNA-774C | Recombinant Cynomolgus PCNA Protein, His-tagged | +Inquiry |
PCNA-626H | Recombinant Human PCNA Protein, MYC/DDK-tagged | +Inquiry |
PCNA-174H | Recombinant Human Proliferating Cell Nuclear Antigen | +Inquiry |
PCNA-1620H | Recombinant Human PCNA Protein, His (Fc)-Avi-tagged | +Inquiry |
PCNA-8977Z | Recombinant Zebrafish PCNA | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCNA-500HCL | Recombinant Human PCNA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCNA Products
Required fields are marked with *
My Review for All PCNA Products
Required fields are marked with *
0
Inquiry Basket