Recombinant Full Length Human Parathyroid Hormone 2 Receptor(Pth2R) Protein, His-Tagged
Cat.No. : | RFL33925HF |
Product Overview : | Recombinant Full Length Human Parathyroid hormone 2 receptor(PTH2R) Protein (P49190) (27-145aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-145) |
Form : | Lyophilized powder |
AA Sequence : | DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPC PPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTH2R |
Synonyms | Parathyroid hormone 2 receptor; Parathyroid hormone receptor precursor ; PTH 2 receptor ; PTH2 receptor; Pth2r; PTH2R_HUMAN; Pthr 2; Pthr2 |
UniProt ID | P49190 |
◆ Recombinant Proteins | ||
RFL13917MF | Recombinant Full Length Mouse Parathyroid Hormone 2 Receptor(Pth2R) Protein, His-Tagged | +Inquiry |
RFL33925HF | Recombinant Full Length Human Parathyroid Hormone 2 Receptor(Pth2R) Protein, His-Tagged | +Inquiry |
PTH2R-13655M | Recombinant Mouse PTH2R Protein | +Inquiry |
PTH2R-4479R | Recombinant Rat PTH2R Protein, His (Fc)-Avi-tagged | +Inquiry |
Pth2r-2669R | Recombinant Rat Pth2r protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTH2R-2704HCL | Recombinant Human PTH2R 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTH2R Products
Required fields are marked with *
My Review for All PTH2R Products
Required fields are marked with *
0
Inquiry Basket