Recombinant Full Length Human PALMD Protein, C-Flag-tagged
Cat.No. : | PALMD-1201HFL |
Product Overview : | Recombinant Full Length Human PALMD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be involved in regulation of cell shape. Predicted to be located in dendrite. Predicted to be active in cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 62.6 kDa |
AA Sequence : | MEEAELVKGRLQAITDKRKIQEEISQKRLKIEEDKLKHQHLKKKALREKWLLDGISSGKEQEEMKKQNQQ DQHQIQVLEQSILRLEKEIQDLEKAELQISTKEEAILKKLKSIERTTEDIIRSVKVEREERAEESIEDIY ANIPDLPKSYIPSRLRKEINEEKEDDEQNRKALYAMEIKVEKDLKTGESTVLSSIPLPSDDFKGTGIKVY DDGQKSVYAVSSNHSAAYNGTDGLAPVEVEELLRQASERNSKSPTEYHEPVYANPFYRPTTPQRETVTPG PNFQERIKIKTNGLGIGVNESIHNMGNGLSEERGNNFNHISPIPPVPHPRSVIQQAEEKLHTPQKRLMTP WEESNVMQDKDAPSPKPRLSPRETIFGKSEHQNSSPTCQEDEEDVRYNIVHSLPPDINDTEPVTMIFMGY QQAEDSEEDKKFLTGYDGIIHAELVVIDDEEEEDEGEAEKPSYHPIAPHSQVYQPAKPTPLPRKRSEASP HENTNHKSPHKNSISLKEQEESLGSPVHHSPFDAQTTGDGTEDPSLTALRMRMAKLGKKVITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | PALMD palmdelphin [ Homo sapiens (human) ] |
Official Symbol | PALMD |
Synonyms | PALML; C1orf11 |
Gene ID | 54873 |
mRNA Refseq | NM_017734.5 |
Protein Refseq | NP_060204.1 |
MIM | 610182 |
UniProt ID | Q9NP74 |
◆ Recombinant Proteins | ||
PALMD-1604H | Recombinant Human PALMD Protein, His (Fc)-Avi-tagged | +Inquiry |
PALMD-4938C | Recombinant Chicken PALMD | +Inquiry |
PALMD-216H | Recombinant Human PALMD Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
PALMD-1201HFL | Recombinant Full Length Human PALMD Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PALMD-3449HCL | Recombinant Human PALMD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PALMD Products
Required fields are marked with *
My Review for All PALMD Products
Required fields are marked with *
0
Inquiry Basket