Recombinant Full Length Human OTUB1 Protein, C-Flag-tagged
Cat.No. : | OTUB1-895HFL |
Product Overview : | Recombinant Full Length Human OTUB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 31.1 kDa |
AA Sequence : | MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQ QKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDF HNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQE VEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Protease |
Full Length : | Full L. |
Gene Name | OTUB1 OTU deubiquitinase, ubiquitin aldehyde binding 1 [ Homo sapiens (human) ] |
Official Symbol | OTUB1 |
Synonyms | OTB1; OTU1; HSPC263 |
Gene ID | 55611 |
mRNA Refseq | NM_017670.3 |
Protein Refseq | NP_060140.2 |
MIM | 608337 |
UniProt ID | Q96FW1 |
◆ Recombinant Proteins | ||
OTUB1-1695H | Recombinant Human OTUB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OTUB1-01H | Active Recombinant Human OTUB1 Protein, His-tagged | +Inquiry |
OTUB1-0548H | Recombinant Human OTUB1 Protein (A25-K271), Flag tagged | +Inquiry |
OTUB1-4974H | Recombinant Human OTUB1 Protein (Met1-Lys271), His tagged | +Inquiry |
OTUB1-173H | Recombinant Human OTUB1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTUB1-3516HCL | Recombinant Human OTUB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OTUB1 Products
Required fields are marked with *
My Review for All OTUB1 Products
Required fields are marked with *
0
Inquiry Basket