Recombinant Full Length Human Olfactory Receptor 9Q2(Or9Q2) Protein, His-Tagged
Cat.No. : | RFL13870HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 9Q2(OR9Q2) Protein (Q8NGE9) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MAERNYTVVTEFFLTAFTEHLQWRVPLFLIFLSFYLATMLGNTGMILLIRGDRRLHTPMY FFLSHLSLVDICYSSAIIPQMLAVLWEHGTTISQARCAAQFFLFTFFASIDCYLLAIMAY DRYTAVCQPLLYVTIITEKARWGLVTGAYVAGFFSAFVRTVTAFTLSFCGNNEINFIFCD LPPLLKLSCGDSYTQEVVIIVFALFVMPACILVILVSYLFIIVAILQIHSAGGRAKTFST CASHLTAVALFFGTLIFMYLRDNTGQSSEGDRVVSVLYTVVTPMLNPLIYSLRNKEVKEA TRKALSKSKPARRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR9Q2 |
Synonyms | OR9Q2; OR9Q2P; Olfactory receptor 9Q2 |
UniProt ID | Q8NGE9 |
◆ Recombinant Proteins | ||
RAB19-13793M | Recombinant Mouse RAB19 Protein | +Inquiry |
IL21-864H | Recombinant Human IL21 Protein | +Inquiry |
MTFR2-2187H | Recombinant Human MTFR2 Protein, His-tagged | +Inquiry |
Pyy-1457R | Recombinant Rat Pyy protein, His & T7-tagged | +Inquiry |
CETN1-1153H | Recombinant Human CETN1 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
Fibrinogen-70P | Active Native Porcine Fibrinogen | +Inquiry |
GPOSP-40 | Active Native Glycerol-3-phosphate oxidase | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
ANPEP-621H | Active Native Human ANPEP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHAL6B-4789HCL | Recombinant Human LDHAL6B 293 Cell Lysate | +Inquiry |
MSANTD3-7932HCL | Recombinant Human C9orf30 293 Cell Lysate | +Inquiry |
CRB3-394HCL | Recombinant Human CRB3 cell lysate | +Inquiry |
ENPP2-1939MCL | Recombinant Mouse ENPP2 cell lysate | +Inquiry |
TPTE-830HCL | Recombinant Human TPTE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR9Q2 Products
Required fields are marked with *
My Review for All OR9Q2 Products
Required fields are marked with *
0
Inquiry Basket