Recombinant Full Length Human Olfactory Receptor 9I1(Or9I1) Protein, His-Tagged
Cat.No. : | RFL29565HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 9I1(OR9I1) Protein (Q8NGQ6) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MAKNNLTRVTEFILMGFMDHPKLEIPLFLVFLSFYLVTLLGNVGMIMLIQVDVKLYTPMY FFLSHLSLLDACYTSVITPQILATLATGKTVISYGHCAAQFFLFTICAGTECFLLAVMAY DRYAAIRNPLLYTVAMNPRLCWSLVVGAYVCGVSGAILRTTCTFTLSFCKDNQINFFFCD LPPLLKLACSDTANIEIVIIFFGNFVILANASVILISYLLIIKTILKVKSSGGRAKTFST CASHITAVALFFGALIFMYLQSGSGKSLEEDKVVSVFYTVVIPMLNPLIYSLRNKDVKDA FRKVARRLQVSLSM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR9I1 |
Synonyms | OR9I1; Olfactory receptor 9I1; Olfactory receptor OR11-228 |
UniProt ID | Q8NGQ6 |
◆ Recombinant Proteins | ||
FCGR1A-12818H | Recombinant Human FCGR1A, His-tagged | +Inquiry |
NARS2-5914M | Recombinant Mouse NARS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
POLB-4561R | Recombinant Rat POLB Protein | +Inquiry |
RCN3-7501M | Recombinant Mouse RCN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MOAE-2895B | Recombinant Bacillus subtilis MOAE protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LHB-8212H | Native Luteinizing Beta Subunit Hormone | +Inquiry |
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
PTI-603B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
Ferritin-20M | Native Mouse Ferritin protein | +Inquiry |
fH-10R | Native Rat fH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELF3-7588HCL | Recombinant Human CELF3 293 Cell Lysate | +Inquiry |
HSF2-5366HCL | Recombinant Human HSF2 293 Cell Lysate | +Inquiry |
IL11RA-2558MCL | Recombinant Mouse IL11RA cell lysate | +Inquiry |
XPOT-1939HCL | Recombinant Human XPOT cell lysate | +Inquiry |
ASPRV1-8641HCL | Recombinant Human ASPRV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR9I1 Products
Required fields are marked with *
My Review for All OR9I1 Products
Required fields are marked with *
0
Inquiry Basket