Recombinant Full Length Human Olfactory Receptor 8K5(Or8K5) Protein, His-Tagged
Cat.No. : | RFL12235HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 8K5(OR8K5) Protein (Q8NH50) (1-307aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-307) |
Form : | Lyophilized powder |
AA Sequence : | MGQHNLTVLTEFILMELTRRPELQIPLFGVFLVIYLITVVGNLTMIILTKLDSHLHTPMY FSIRHLAFVDLGNSTVICPKVLANFVVDRNTISYYACAAQLAFFLMFIISEFFILSAMAY DRYVAICNPLLYYVIMSQRLCHVLVGIQYLYSTFQALMFTIKIFTLTFCGSNVISHFYCD DVPLLPMLCSNAQEIELLSILFSVFNLISSFLIVLVSYMLILLAICQMHSAEGRKKAFST CGSHLTVVVVFYGSLLFMYMQPNSTHFFDTDKMASVFYTLVIPMLNPLIYSLRNEEVKNA FYKLFEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR8K5 |
Synonyms | OR8K5; Olfactory receptor 8K5; Olfactory receptor OR11-174 |
UniProt ID | Q8NH50 |
◆ Recombinant Proteins | ||
HA-455H | Active Recombinant H7N8 HA, His-tagged | +Inquiry |
xsc-4632R | Recombinant Rhizobium meliloti (strain 1021)xsc protein, His&Myc-tagged | +Inquiry |
KLRC2-634H | Recombinant Human KLRC2 protein, His-Avi-tagged | +Inquiry |
Spata7-269M | Recombinant Mouse Spata7 Protein, MYC/DDK-tagged | +Inquiry |
Rdh10-5443M | Recombinant Mouse Rdh10 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
PLG-27842TH | Native Human PLG | +Inquiry |
COL1-118H | Native Human Collagen Type I protein | +Inquiry |
Troponin-16R | Native Rabbit Skeletal Muscle Troponin ITC Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASF1B-001HCL | Recombinant Human ASF1B cell lysate | +Inquiry |
C6-1647HCL | Recombinant Human C6 cell lysate | +Inquiry |
PMFBP1-1382HCL | Recombinant Human PMFBP1 cell lysate | +Inquiry |
ONECUT1-3576HCL | Recombinant Human ONECUT1 293 Cell Lysate | +Inquiry |
RNMTL1-1530HCL | Recombinant Human RNMTL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR8K5 Products
Required fields are marked with *
My Review for All OR8K5 Products
Required fields are marked with *
0
Inquiry Basket