Recombinant Full Length Human Olfactory Receptor 7G3(Or7G3) Protein, His-Tagged
Cat.No. : | RFL33415HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 7G3(OR7G3) Protein (Q8NG95) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MKAGNFSDTPEFFLLGLSGDPELQPILFMLFLSMYLATMLGNLLIILAVNSDSHLHTPMY FLLSILSLVDICFTSTTMPKMLVNIQAQAQSINYTGCLTQICFVLVFVGLENGILVMMAY DRFVAICHPLRYNVIMNPKLCGLLLLLSFIVSVLDALLHTLMVLQLTFCIDLEIPHFFCE LAHILKLACSDVLINNILVYLVTSLLGVVPLSGIIFSYTRIVSSVMKIPSAGGKYKAFSI CGSHLIVVSLFYGTGFGVYLSSGATHSSRKGAIASVMYTVVTPMLNPLIYSLRNKDMLKA LRKLISRIPSFH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR7G3 |
Synonyms | OR7G3; Olfactory receptor 7G3; OST085; Olfactory receptor OR19-9 |
UniProt ID | Q8NG95 |
◆ Recombinant Proteins | ||
Tnfrsf10b-3321MAF647 | Recombinant Mouse Tnfrsf10b Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
ABCD3-411R | Recombinant Rat ABCD3 Protein | +Inquiry |
MSLN-0385C | Recombinant Cynomolgus MSLN protein, His-tagged | +Inquiry |
ABI1-086H | Recombinant Human ABI1 Protein, GST-Tagged | +Inquiry |
Hnmt-4643M | Recombinant Mouse Hnmt protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
MB-01B | Native Bovine MB Protein | +Inquiry |
Trypsin-265H | Native Human Trypsin | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
ECGS-32B | Native Bovine ECGS | +Inquiry |
◆ Cell & Tissue Lysates | ||
BBS5-8501HCL | Recombinant Human BBS5 293 Cell Lysate | +Inquiry |
TLE3-1784HCL | Recombinant Human TLE3 cell lysate | +Inquiry |
SCAPER-2004HCL | Recombinant Human SCAPER cell lysate | +Inquiry |
DEFB126-6982HCL | Recombinant Human DEFB126 293 Cell Lysate | +Inquiry |
DDR1-1709MCL | Recombinant Mouse DDR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR7G3 Products
Required fields are marked with *
My Review for All OR7G3 Products
Required fields are marked with *
0
Inquiry Basket