Recombinant Full Length Human Olfactory Receptor 6V1(Or6V1) Protein, His-Tagged
Cat.No. : | RFL30478HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 6V1(OR6V1) Protein (Q8N148) (1-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-313) |
Form : | Lyophilized powder |
AA Sequence : | MANLSQPSEFVLLGFSSFGELQALLYGPFLMLYLLAFMGNTIIIVMVIADTHLHTPMYFF LGNFSLLEILVTMTAVPRMLSDLLVPHKVITFTGCMVQFYFHFSLGSTSFLILTDMALDR FVAICHPLRYGTLMSRAMCVQLAGAAWAAPFLAMVPTVLSRAHLDYCHGDVINHFFCDNE PLLQLSCSDTRLLEFWDFLMALTFVLSSFLVTLISYGYIVTTVLRIPSASSCQKAFSTCG SHLTLVFIGYSSTIFLYVRPGKAHSVQVRKVVALVTSVLTPFLNPFILTFCNQTVKTVLQ GQMQRLKGLCKAQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR6V1 |
Synonyms | OR6V1; Olfactory receptor 6V1; Olfactory receptor OR7-3 |
UniProt ID | Q8N148 |
◆ Recombinant Proteins | ||
KCNN2-2357H | Recombinant Human KCNN2 Protein, His-tagged | +Inquiry |
RFL18292PF | Recombinant Full Length Photobacterium Profundum Fumarate Reductase Subunit D(Frdd) Protein, His-Tagged | +Inquiry |
PBK-4643H | Recombinant Human PBK protein, GST-tagged | +Inquiry |
MZB1-4085H | Recombinant Human MZB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RXRA-28521TH | Recombinant Human RXRA | +Inquiry |
◆ Native Proteins | ||
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
Thrombin-29B | Active Native Bovine alpha-Thrombin-FPRck | +Inquiry |
FGG -36D | Native Canine Fibrinogen | +Inquiry |
FSME-08 | Native FSME (TBE) Virus Antigen (Premium) | +Inquiry |
FTH1-28156TH | Native Human FTH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MORN5-4248HCL | Recombinant Human MORN5 293 Cell Lysate | +Inquiry |
IL17RB-871HCL | Recombinant Human IL17RB cell lysate | +Inquiry |
GBP1-1686HCL | Recombinant Human GBP1 cell lysate | +Inquiry |
NLGN1-1564MCL | Recombinant Mouse NLGN1 cell lysate | +Inquiry |
ENPP2-1939MCL | Recombinant Mouse ENPP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR6V1 Products
Required fields are marked with *
My Review for All OR6V1 Products
Required fields are marked with *
0
Inquiry Basket