Recombinant Full Length Human Olfactory Receptor 6P1(Or6P1) Protein, His-Tagged
Cat.No. : | RFL7176HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 6P1(OR6P1) Protein (Q8NGX9) (1-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-317) |
Form : | Lyophilized powder |
AA Sequence : | MRNLSGGHVEEFVLVGFPTTPPLQLLLFVLFFAIYLLTLLENALIVFTIWLAPSLHRPMY FFLGHLSFLELWYINVTIPRLLAAFLTQDGRVSYVGCMTQLYFFIALACTECVLLAVMAY DRYLAICGPLLYPSLMPSSLATRLAAASWGSGFFSSMMKLLFISQLSYCGPNIINHFFCD ISPLLNLTCSDKEQAELVDFLLALVMILLPLLAVVSSYTAIIAAILRIPTSRGRHKAFST CAAHLAVVVIYYSSTLFTYARPRAMYTFNHNKIISVLYTIIVPFFNPAIYCLRNKEVKEA FRKTVMGRCHYPRDVQD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR6P1 |
Synonyms | OR6P1; Olfactory receptor 6P1; Olfactory receptor OR1-12 |
UniProt ID | Q8NGX9 |
◆ Recombinant Proteins | ||
Aldh3a1-1109M | Recombinant Mouse Aldh3a1 protein, His&Myc-tagged | +Inquiry |
SE1391-3160S | Recombinant Staphylococcus epidermidis ATCC 12228 SE1391 protein, His-tagged | +Inquiry |
TEK-41H | Active Recombinant Human TEK protein (Y897H R915C), GST-tagged | +Inquiry |
CD320-044H | Recombinant Human CD320 Protein, HIS-tagged | +Inquiry |
PAWR-459H | Recombinant Human PAWR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
BL-001C | Native Cynomolgus Brain Total Protein Lysates | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
Complement C3a-46H | Native Human Complement C3a | +Inquiry |
IgG-7438M | Native Mouse IgG Fc Protein, Biotin conjugated | +Inquiry |
Prostate-016H | Human Prostate Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPV-7574HCL | Recombinant Human CENPV 293 Cell Lysate | +Inquiry |
HA-2328HCL | Recombinant H10N3 HA cell lysate | +Inquiry |
HOXC6-5416HCL | Recombinant Human HOXC6 293 Cell Lysate | +Inquiry |
CHRND-7510HCL | Recombinant Human CHRND 293 Cell Lysate | +Inquiry |
ARFIP2-8749HCL | Recombinant Human ARFIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR6P1 Products
Required fields are marked with *
My Review for All OR6P1 Products
Required fields are marked with *
0
Inquiry Basket